Anti-RIPK4 antibody
| Name | Anti-RIPK4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84365 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Dog |
| Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 734-783 (GLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSK T) of Human RIPK4 (NP_065690) |
| Description | Rabbit Polyclonal |
| Gene | RIPK4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RIPK4 antibody (ab84365) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryanti-Rabbit IgG HRP at 1/50000 dilution