Name | Anti-RIPK4 antibody |
---|---|
Supplier | Abcam |
Catalog | ab84365 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Dog |
Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 734-783 (GLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSK T) of Human RIPK4 (NP_065690) |
Description | Rabbit Polyclonal |
Gene | RIPK4 |
Conjugate | Unconjugated |
Supplier Page | Shop |