Anti-RLBP1L1 antibody
| Name | Anti-RLBP1L1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81315 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 109-158 (NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDI L) of Human RLBP1L1, NP_775790 |
| Description | Rabbit Polyclonal |
| Gene | CLVS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RLBP1L1 antibody (ab81315) at 1 µg/ml + Human fetal lung lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution