Anti-RNASE9 antibody
| Name | Anti-RNASE9 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84689 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Pig, Chimpanzee |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 35-84 (PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCN H) of Human RNASE9 (NP_001001673) |
| Description | Rabbit Polyclonal |
| Gene | RNASE9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RNASE9 antibody (ab84689) at 1 µg/ml + Placenta lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution