Anti-RNF39 antibody
| Name | Anti-RNF39 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab104747 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 178-227 CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL of Human RNF39 (NP_739576) |
| Description | Rabbit Polyclonal |
| Gene | RNF39 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RNF39 antibody (ab104747) at 2.5 µg/ml + HepG2 cell lysate at 10 µg