Anti-RNF90 antibody
| Name | Anti-RNF90 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125314 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Bovine, Cat, Dog, Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 52-101 ( CIMRCWERPGAGTGTVTRTLPCPLPCPQCREPARPSQLRPNRQLAAVASL ) of Rat RNF90 (UniProt: D3ZNJ9) |
| Description | Rabbit Polyclonal |
| Gene | TRIM7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RNF90 antibody (ab125314) at 1 µg/ml + Rat liver lysate at 10 µg