Anti-Robo2 antibody
| Name | Anti-Robo2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85278 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding a region from the N-terminal amino acids 252-301 ( PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK ) of human Robo2 (NP_002933) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ROBO2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Robo2 antibody (ab85278) at 1 µg/ml + Human Fetal Brain Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1: 50,000
Lanes 1 - 4 : Anti-Robo2 antibody (ab85278) at 1/500 dilutionLanes 5 - 8 : Rabbit Polyclonal to V5 TagLane 1 : EmptyLane 2 : HEK293 cells expressing Robo1Lane 3 : HEK293 cells expressing Robo2-V5Lane 4 : HEK293 cells expressing Robo3Lane 5 : EmptyLane 6 : HEK293 cells expressing Robo1Lane 7 : HEK293 cells expressing Robo2-V5Lane 8 : HEK293 cells expressing Robo3Lysates/proteins at 20 µg per lane.SecondaryDonkey Polyclonal to rabbit IgG Conjugated to HRP at 1/20000 dilutiondeveloped using the ECL techniquePerformed under reducing conditions.