Anti-RPIA antibody
| Name | Anti-RPIA antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86123 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 (QRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG T) of Human RPIA, NP_653164 |
| Description | Rabbit Polyclonal |
| Gene | RPIA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RPIA antibody (ab86123) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution