Name | Anti-RPIA antibody |
---|---|
Supplier | Abcam |
Catalog | ab86123 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 (QRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSG T) of Human RPIA, NP_653164 |
Description | Rabbit Polyclonal |
Gene | RPIA |
Conjugate | Unconjugated |
Supplier Page | Shop |