Anti-RPL34 antibody
| Name | Anti-RPL34 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133843 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 68-117 ( SKTKKHVSRAYGGSMCAKCVRDRIKRAFLIEEQKIVVKVLKAQAQSQKAK ) of Human RPL34 (NP_000986) |
| Description | Rabbit Polyclonal |
| Gene | RPL34 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RPL34 antibody (ab133843) at 1 µg/ml + Human fetal liver lysate at 10 µg