Anti-RPL37A antibody
| Name | Anti-RPL37A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98095 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 42-91 (CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELK D) of Human RPL37A (NP_000989) |
| Blocking Peptide | RPL37A peptide |
| Description | Rabbit Polyclonal |
| Gene | RPL37A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RPL37A antibody (ab98095) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG diluted at 1/50000 dilution