Anti-RPS3 antibody
| Name | Anti-RPS3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125372 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 191-240 ( PWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPV ) of Human RPS3 (P23396) |
| Description | Rabbit Polyclonal |
| Gene | RPS3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RPS3 antibody (ab125372) at 1 µg/ml + Human fetal kidney lysate at 10 µg