Anti-RRP12 antibody - C-terminal
| Name | Anti-RRP12 antibody - C-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab136631 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 1126-1175 ( AQRVLATQPGPGRGRKKDHGFKVSADGRLIIREEADGNKMEEEEGAKGED ) of Human RRP12 (NM_015179) |
| Description | Rabbit Polyclonal |
| Gene | RRP12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RRP12 antibody - C-terminal (ab136631) at 1 µg/ml + 293T cell lysate at 10 µg