Anti-RSPH10B antibody
| Name | Anti-RSPH10B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90954 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 288-337 (FVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN D) of Human RSPH10B (NP_775836) |
| Description | Rabbit Polyclonal |
| Gene | RSPH10B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RSPH10B antibody (ab90954) at 1 µg/ml + Jurkat cell lysate at 10 µgSecondaryHRP goat anti rabbit IgG at 1/50000 dilution