Anti-RWDD2A antibody
| Name | Anti-RWDD2A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87779 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36 - 85 ( ALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVAL ) of Human RWDD2A (NP_219479) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | RWDD2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RWDD2A antibody (ab87779) at 1 µg/ml + Human fetal thymus lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution