Anti-RWDD4A antibody
| Name | Anti-RWDD4A antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89737 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 (SANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEIS W) of Human RWDD4A (NP_689895) |
| Description | Rabbit Polyclonal |
| Gene | RWDD4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RWDD4A antibody (ab89737) at 1 µg/ml + Human fetal intestine lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution