Name | Anti-SAA4 antibody |
---|---|
Supplier | Abcam |
Catalog | ab99182 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Bovine, Pig |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 80-129 ( RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK ) of Human SAA4 (NP_006503) |
Description | Rabbit Polyclonal |
Gene | SAA4 |
Conjugate | Unconjugated |
Supplier Page | Shop |