Anti-SAA4 antibody
| Name | Anti-SAA4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99182 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Bovine, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 80-129 ( RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK ) of Human SAA4 (NP_006503) |
| Description | Rabbit Polyclonal |
| Gene | SAA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SAA4 antibody (ab99182) at 1 µg/ml + Human Fetal Stomach Lysate at 10 µg