Anti-SCUBE2 antibody
| Name | Anti-SCUBE2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82987 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 683-732 (KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCG G) of Human SCUBE2 (NP_066025) |
| Description | Rabbit Polyclonal |
| Gene | SCUBE2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SCUBE2 antibody (ab82987) at 1 µg/ml + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution