Anti-SEC14L4 antibody
| Name | Anti-SEC14L4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89960 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2 - 51 ( SSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQK ) of Human SEC14L4 (NP_777637) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SEC14L4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SEC14L4 antibody (ab89960) at 1 µg/ml + OVCAR-3 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution