Anti-Securin 2 antibody
| Name | Anti-Securin 2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81181 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rabbit, Horse, Bovine, Cat, Dog, Pig, Chimpanzee |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 73-122 (SVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPFNL L) of Human Securin 2, NP_006598 |
| Description | Rabbit Polyclonal |
| Gene | PTTG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Securin 2 antibody (ab81181) at 1 µg/ml + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution