Anti-Semenogelin II antibody
| Name | Anti-Semenogelin II antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108085 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Pig, Monkey |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 42-91 ( GQKGQHYFGQKDQQHTKSKGSFSIQHTYHVDINDHDWTRKSQQYDLNALH ) of human Semenogelin II (NP_002999) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SEMG2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Semenogelin II antibody (ab108085) at 1 µg/ml + COLO205 cell lysate at 10 µg