Anti-SFRS7 antibody
| Name | Anti-SFRS7 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90860 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2 - 51 ( SRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAF ) of Human SFRS7 (NP_001026854) |
| Description | Rabbit Polyclonal |
| Gene | SRSF7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SFRS7 antibody (ab90860) at 1 µg/ml + Human fetal lung lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution