Name | Anti-SFRS8 antibody |
---|---|
Supplier | Abcam |
Catalog | ab85641 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLS E) of Human SFRS8, NP_004583 |
Description | Rabbit Polyclonal |
Gene | SFSWAP |
Conjugate | Unconjugated |
Supplier Page | Shop |