Anti-SFRS8 antibody
| Name | Anti-SFRS8 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85641 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLS E) of Human SFRS8, NP_004583 |
| Description | Rabbit Polyclonal |
| Gene | SFSWAP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SFRS8 antibody (ab85641) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution