Anti-SGCE antibody
| Name | Anti-SGCE antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84660 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Mouse, Human, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDP I) of human SGCE (NP_001092871) |
| Description | Rabbit Polyclonal |
| Gene | SGCE |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry with pFA fixed Human skeletal muscle tissue at an antibody concentration of 5.0ug/ml using anti-SGCE antibody (ab84660)
ab84660 at a 1/500 dilution staining SGCE in Mouse cerebellum tissue by Immunohistochemistry.
Anti-SGCE antibody (ab84660) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution