Anti-SHKBP1 antibody
| Name | Anti-SHKBP1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab133862 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 70-119 ( TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS ) of Human SHKBP1 (NP_612401; Q8TBC3) |
| Description | Rabbit Polyclonal |
| Gene | SHKBP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SHKBP1 antibody (ab133862) at 1 µg/ml + HepG2 lysate at 10 µg with 5% skimmed milk