Anti-SHOX2 antibody
| Name | Anti-SHOX2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82918 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Zebrafish, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 179 - 228 (SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGAL R) of Human SHOX2, (NP_006875) |
| Blocking Peptide | Human SHOX2 peptide |
| Description | Rabbit Polyclonal |
| Gene | SHOX2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SHOX2 antibody (ab82918) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
All lanes : Anti-SHOX2 antibody (ab82918) at 1 µg/mlLane 1 : MarkerLane 2 : Zebrafish brain homogenate at 20 µgLane 3 : Zebrafish heart homogenate at 20 µgLane 4 : Zebrafish liver homogenate at 20 µgSecondaryGoat polyclonal to Rabbit IgG – H&L – Pre-Adsorbed (HRP) at 1/6000 dilutiondeveloped using the ECL techniquePerformed under reducing conditions.