Anti-SIDT2 antibody
| Name | Anti-SIDT2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85847 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 72-121 of Human SIDT2 ( LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT ) NP_001035545 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SIDT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SIDT2 antibody (ab85847) at 1 µg/ml + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution