Name | Anti-SLC22A14 antibody |
---|---|
Supplier | Abcam |
Catalog | ab84063 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Cat |
Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 144-194 ( IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG ) of Human SLC22A14 (NP_004794) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | SLC22A14 |
Conjugate | Unconjugated |
Supplier Page | Shop |