Anti-SLC22A14 antibody
| Name | Anti-SLC22A14 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84063 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Cat |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 144-194 ( IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG ) of Human SLC22A14 (NP_004794) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SLC22A14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SLC22A14 antibody (ab84063) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution