Anti-SLC25A25 antibody
| Name | Anti-SLC25A25 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99100 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 ( MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDG ) of Human SLC25A25 isoform C (NP_001006643) |
| Description | Rabbit Polyclonal |
| Gene | SLC25A25 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SLC25A25 antibody (ab99100) at 1 µg/ml + THP-1 cell lysate at 10 µg