Anti-SLC27A6 antibody
| Name | Anti-SLC27A6 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84183 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P ICC/IF ICC/IF |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Drosophila, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the middle amino acids 215-264 (KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLP L) of Human SLC27A6 (NP_001017372) |
| Description | Rabbit Polyclonal |
| Gene | SLC27A6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pineal tissue labelling SLC27A6 with ab84183 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the membrane and cytoplasm of cell bodies of pinealocytes and their processes. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - SLC27A6. Right - Merge.
Anti-SLC27A6 antibody (ab84183) at 1 µg/ml + MCF7 membrane lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
ICC/IF image of ab84183 stained HeLa cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab84183, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899 Dylight 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.