Anti-SLC34A3 antibody
| Name | Anti-SLC34A3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83093 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within amino acids 180-229 ( GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL ) of Human SLC34A3 (NP_543153) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SLC34A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SLC34A3 antibody (ab83093) at 1 µg/ml + Human fetal lung lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution