Name | Anti-SLC34A3 antibody |
---|---|
Supplier | Abcam |
Catalog | ab83093 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide corresponding to a region within amino acids 180-229 ( GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL ) of Human SLC34A3 (NP_543153) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | SLC34A3 |
Conjugate | Unconjugated |
Supplier Page | Shop |