Anti-SLC34A3 antibody
| Name | Anti-SLC34A3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab97839 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 215 - 264 ( LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG ) of Human SLC34A3 (NP_543153) |
| Blocking Peptide | SLC34A3 peptide |
| Description | Rabbit Polyclonal |
| Gene | SLC34A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SLC34A3 antibody (ab97839) at 1 µg/ml (in 5% skim milk / PBS buffer) + COLO205 cell lysate at 10 µgSecondaryHRP-conjugated anti-Rabbit IgG at 1/50000 dilution