Anti-SLC35E2 antibody
| Name | Anti-SLC35E2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102033 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 215-264 ( AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP ) of Human SLC35E2 (NP_878258) |
| Description | Rabbit Polyclonal |
| Gene | SLC35E2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SLC35E2 antibody (ab102033) at 1 µg/ml + COLO205 Cell Lysate at 10 µg