Name | Anti-SLC35F3 antibody |
---|---|
Supplier | Abcam |
Catalog | ab82692 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 215-264 (LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLS W) of Human SLC35F3 (NP_775779) |
Description | Rabbit Polyclonal |
Gene | SLC35F3 |
Conjugate | Unconjugated |
Supplier Page | Shop |