Anti-SLC39A2 antibody
| Name | Anti-SLC39A2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99071 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 71-120 ( EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE ) of Human SLC39A2 (NP_055394) |
| Description | Rabbit Polyclonal |
| Gene | SLC39A2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SLC39A2 antibody (ab99071) at 1/1 dilution + PANC1 cell lysate at 10 µg