Anti-SLC39A9 antibody
| Name | Anti-SLC39A9 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102030 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Horse, Chicken, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 ( YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA ) of Human SLC39A9 (NP_060845) |
| Description | Rabbit Polyclonal |
| Gene | SLC39A9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SLC39A9 antibody (ab102030) at 1 µg/ml + U937 Cell Lysate at 10 µg