Name | Anti-SLC39A9 antibody |
---|---|
Supplier | Abcam |
Catalog | ab102030 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Horse, Chicken, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 107-156 ( YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA ) of Human SLC39A9 (NP_060845) |
Description | Rabbit Polyclonal |
Gene | SLC39A9 |
Conjugate | Unconjugated |
Supplier Page | Shop |