Anti-SLFN12 antibody
| Name | Anti-SLFN12 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99200 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Bovine |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 ( KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS ) of Human SLFN12 (NP_060512) |
| Description | Rabbit Polyclonal |
| Gene | SLFN12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SLFN12 antibody (ab99200) at 1 µg/ml + Human fetal stomach lysate at 10 µg