Anti-SNAPC3 antibody

Name Anti-SNAPC3 antibody
Supplier Abcam
Catalog ab94560
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog
Antigen Synthetic peptide corresponding to a region within internal sequence amino acids 216-265 ( RDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRYP ) of Human SNAPC3 (NP_001034786)
Description Rabbit Polyclonal
Gene SNAPC3
Conjugate Unconjugated
Supplier Page Shop

Product images