Anti-SNAPC3 antibody
| Name | Anti-SNAPC3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94560 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 216-265 ( RDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRYP ) of Human SNAPC3 (NP_001034786) |
| Description | Rabbit Polyclonal |
| Gene | SNAPC3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SNAPC3 antibody (ab94560) at 1 µg/ml + PANC1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilutionObserved band size : 47 kDa (why is the actual band size different from the predicted?)