Anti-SNX7 antibody
| Name | Anti-SNX7 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98159 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 359-408 ( LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND ) of Human SNX7 (NP_057060) |
| Description | Rabbit Polyclonal |
| Gene | SNX7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SNX7 antibody (ab98159) at 1 µg/ml + Human fetal liver lysate at 10 µg