Anti-Solute carrier family 22 member 18 antibody
| Name | Anti-Solute carrier family 22 member 18 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83674 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Horse, Guinea Pig, Bovine |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 108-157 (AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRL G) of Human Solute carrier family 22 member 18 (NP_002546) |
| Description | Rabbit Polyclonal |
| Gene | SLC22A18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Solute carrier family 22 member 18 antibody (ab83674) at 1 µg/ml + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution