Anti-Somatostatin Receptor 3 antibody
| Name | Anti-Somatostatin Receptor 3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125404 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Yeast |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 337-386 (SQEPTVGPPEKTEEEDEEEEDGEESREGGKGKEMNGRVSQITQPGTSGQ E) of Human Somatostatin Receptor 3 (NP_001042; P32745) |
| Description | Rabbit Polyclonal |
| Gene | SSTR3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Somatostatin Receptor 3 antibody (ab125404) at 1 µg/ml + Fetal Kidney Lysate