Anti-SPACA4 antibody
| Name | Anti-SPACA4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125313 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Bovine, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 39-88 ( MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTT ) of Human SPACA4 (NP_598005) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SPACA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SPACA4 antibody (ab125313) at 1 µg/ml + Jurkat cell lysate at 10 µg