Anti-SPAG7 antibody - N-terminal
| Name | Anti-SPAG7 antibody - N-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab136635 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 16-65 ( PSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSGQ ) of Human SPAG7 (NM_004890) |
| Description | Rabbit Polyclonal |
| Gene | SPAG7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SPAG7 antibody - N-terminal (ab136635) at 1 µg/ml + Human fetal liver lysate at 10 µg