Anti-SPRYD3 antibody
| Name | Anti-SPRYD3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113782 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 98-147 ( LVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCNSGDRIGC ) of Human SPRYD3 (NP_116229) |
| Description | Rabbit Polyclonal |
| Gene | SPRYD3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SPRYD3 antibody (ab113782) at 1 µg/ml + Human Fetal Heart Lysate at 10 µg