Anti-STARS antibody
| Name | Anti-STARS antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab116046 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Human, Rat, Rabbit, Horse, Chicken, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 284-333 ( KEGSKTAERAKRAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDR ) of Mouse STARS (NP_780665) |
| Description | Rabbit Polyclonal |
| Gene | ABRA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-STARS antibody (ab116046) at 100 µg/ml + Mouse heart lysate at 10 µg