Anti-STK16 antibody
| Name | Anti-STK16 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85638 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Goat, Horse, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 215-264 (TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSA L) of Human STK16, NP_003682 |
| Description | Rabbit Polyclonal |
| Gene | STK16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-STK16 antibody (ab85638) at 1 µg/ml + Fetal brain lysate (Human) at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution