Anti-SUNC1 antibody
| Name | Anti-SUNC1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81495 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 253-302 ATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFLGQF of Human SUNC1, NP_001025190 |
| Description | Rabbit Polyclonal |
| Gene | SUN3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-SUNC1 antibody (ab81495) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution