Anti-Superoxide Dismutase 4 antibody
| Name | Anti-Superoxide Dismutase 4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113915 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 126-175 ( LHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADA ) of Human Superoxide Dismutase 4 (NP_005116) |
| Description | Rabbit Polyclonal |
| Gene | CCS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Superoxide Dismutase 4 antibody (ab113915) at 1 µg/ml + Human Fetal Liver Lysate at 10 µg