Anti-TAF5L antibody
| Name | Anti-TAF5L antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90267 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 432 - 481 ( VKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGK ) of Human TAF5L (NP_055224) |
| Description | Rabbit Polyclonal |
| Gene | TAF5L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TAF5L antibody (ab90267) at 1 µg/ml + Human fetal stomach lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution