Name | Anti-TAF5L antibody |
---|---|
Supplier | Abcam |
Catalog | ab90267 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 432 - 481 ( VKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGK ) of Human TAF5L (NP_055224) |
Description | Rabbit Polyclonal |
Gene | TAF5L |
Conjugate | Unconjugated |
Supplier Page | Shop |