Name | Anti-TBC1D1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab84692 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | IHC-P WB |
Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat |
Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 611-660 (RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS W) of Human TBC1D1 (NP_055988) |
Description | Rabbit Polyclonal |
Gene | TBC1D1 |
Conjugate | Unconjugated |
Supplier Page | Shop |