Anti-TBC1D1 antibody
| Name | Anti-TBC1D1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84692 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 611-660 (RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS W) of Human TBC1D1 (NP_055988) |
| Description | Rabbit Polyclonal |
| Gene | TBC1D1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
