Anti-TBLR1 antibody
| Name | Anti-TBLR1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab13799 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Human |
| Antigen | Synthetic peptide: WPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEW T , corresponding to amino acids 200-250 of Human TBLR1 |
| Description | Rabbit Polyclonal |
| Gene | TBL1XR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Western blot analysis of the two forms of TBLR1 in 20 µgs of human brain cell lysate using ab13799 at 1 µg/ml.