Anti-TCEAL6 antibody
| Name | Anti-TCEAL6 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108072 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 134-183 (LSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAQGDNGVSG E) of Human TCEAL6 (NP_001006939) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | TCEAL6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-TCEAL6 antibody (ab108072) at 1 µg/ml + Jurkat cell lysate at 10 µg