Anti-TCEAL6 antibody

Name Anti-TCEAL6 antibody
Supplier Abcam
Catalog ab108072
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within C terminal amino acids 134-183 (LSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAQGDNGVSG E) of Human TCEAL6 (NP_001006939) Run BLAST with Run BLAST with
Description Rabbit Polyclonal
Gene TCEAL6
Conjugate Unconjugated
Supplier Page Shop

Product images